Acipenser ruthenus (sterlet): 117421010 Help Entry 117421010         CDS       T07327                                  Name (RefSeq) thioredoxin-like   KO K03671   thioredoxin Organism arut  Acipenser ruthenus (sterlet) Pathway arut04621   NOD-like receptor signaling pathway arut05132   Salmonella infection Brite KEGG Orthology (KO) [BR:arut00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     117421010  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117421010  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:arut03110]     117421010 Chaperones and folding catalysts [BR:arut03110]  Protein folding catalysts   Protein disulfide isomerase    117421010 SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 OST3_OST6 Thioredoxin_9 AhpC-TSA DIM1 Thioredoxin_8 Thioredoxin_7 Redoxin PedC-like Glutaredoxin TXD17-like_Trx TraF BrxC Motif Other DBs NCBI-GeneID:  117421010 NCBI-ProteinID:  XP_033890742 LinkDB All DBs Position 1 Genome browser AA seq 105 aa AA seqDB search MVRFIESKAEFEEALKDAGSRLVIVDFTATWCGPCKMISPVFEKLAEEHKDVVFLKVDVD DAQDVAEMCKVSSMPTFQFFKNGQKVEEFSGANKDKLSEMLMKYK NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggttcgtttcatcgagagcaaggctgagtttgaagaagctctgaaggatgctggttct aggcttgtgattgtagatttcacagccacctggtgtgggccatgcaaaatgatttctcca gtttttgaaaaacttgctgaagagcacaaagatgttgtgtttctaaaggttgacgtggat gatgctcaggacgttgctgagatgtgtaaagtcagcagcatgcctacattccagttcttc aaaaatggccagaaggttgaagaattttcaggagccaacaaggacaaactttcagaaatg ctaatgaaatacaagtag

DBGET integrated database retrieval system