Acipenser ruthenus (sterlet): 117428047 Help Entry 117428047         CDS       T07327                                  Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism arut  Acipenser ruthenus (sterlet) Pathway arut04010   MAPK signaling pathway arut04012   ErbB signaling pathway arut04068   FoxO signaling pathway arut04137   Mitophagy - animal arut04140   Autophagy - animal arut04150   mTOR signaling pathway arut04210   Apoptosis arut04218   Cellular senescence arut04370   VEGF signaling pathway arut04371   Apelin signaling pathway arut04519   Cadherin signaling arut04540   Gap junction arut04625   C-type lectin receptor signaling pathway arut04810   Regulation of actin cytoskeleton arut04910   Insulin signaling pathway arut04912   GnRH signaling pathway arut04916   Melanogenesis Brite KEGG Orthology (KO) [BR:arut00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     117428047    04012 ErbB signaling pathway     117428047    04370 VEGF signaling pathway     117428047    04371 Apelin signaling pathway     117428047    04068 FoxO signaling pathway     117428047    04150 mTOR signaling pathway     117428047   09133 Signaling molecules and interaction    04519 Cadherin signaling     117428047  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     117428047    04137 Mitophagy - animal     117428047   09143 Cell growth and death    04210 Apoptosis     117428047    04218 Cellular senescence     117428047   09144 Cellular community - eukaryotes    04540 Gap junction     117428047   09142 Cell motility    04810 Regulation of actin cytoskeleton     117428047  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     117428047   09152 Endocrine system    04910 Insulin signaling pathway     117428047    04912 GnRH signaling pathway     117428047    04916 Melanogenesis     117428047  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:arut04131]     117428047   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:arut04147]     117428047    04031 GTP-binding proteins [BR:arut04031]     117428047 Membrane trafficking [BR:arut04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     117428047  Endocytosis   Macropinocytosis    Ras GTPases     117428047 Exosome [BR:arut04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    117428047   Exosomal proteins of other body fluids (saliva and urine)    117428047   Exosomal proteins of breast cancer cells    117428047   Exosomal proteins of colorectal cancer cells    117428047 GTP-binding proteins [BR:arut04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     117428047 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin TP0183_N Ldh_1_N Motif Other DBs NCBI-GeneID:  117428047 NCBI-ProteinID:  XP_033902478 LinkDB All DBs Position 37 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADIHLYREQIKRVKDADDVPMVLVGNKCDL PTRTVDTKQAQELARSYGIEFVETSAKTRQGVEDAFYTLVREIQQYRMKKLNSSEDLKQG CMGVSCAVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagagtataaactggtggtggtgggagctggtggagtgggtaaaagcgccttgaca atccagctcattcagaaccatttcgtagatgaatatgatccaaccattgaggactcatac aggaagcaggtggtgattgacggtgagacgtgtttgttggacatcctggacacagctgga caggaggagtacagtgccatgcgggaccagtacatgaggacaggagagggcttcctctgc gtcttcgccatcaacaacagcaagtccttcgcagacatccacctgtacagagagcagatc aagcgcgtgaaggacgctgacgatgtcccgatggtgctggtggggaataagtgtgacctg ccgacgcggacggtggacacaaagcaggctcaggaactcgctaggagttacgggatcgag tttgtggagacatcggcaaagacaagacagggcgtggaggatgcgttctacacactggtg cgggagatccagcagtaccgcatgaagaagctgaacagcagcgaggacctcaagcagggc tgcatgggggtgtcctgcgccgtgatgtga

DBGET integrated database retrieval system