Acipenser ruthenus (sterlet): 117433135 Help Entry 117433135         CDS       T07327                                  Name (RefSeq) dynein light chain 4, axonemal   KO K10412   dynein axonemal light chain 4 Organism arut  Acipenser ruthenus (sterlet) Pathway arut04814   Motor proteins Brite KEGG Orthology (KO) [BR:arut00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     117433135  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:arut03037]     117433135    04812 Cytoskeleton proteins [BR:arut04812]     117433135 Cilium and associated proteins [BR:arut03037]  Motile cilia and associated proteins   Dynein arm    117433135 Cytoskeleton proteins [BR:arut04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      117433135 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Ground-like DUF6935 Motif Other DBs NCBI-GeneID:  117433135 NCBI-ProteinID:  XP_034766665 LinkDB All DBs Position 35:complement(2307355..2311076) Genome browser AA seq 106 aa AA seqDB search MAEPAESKKEEADYKRVHSFPLVRHTDMPEEMRVETMELCVTACEKYATNNENAAKMIKE SMDKKFGSSWHVVIGEGFGFEVTHEVKNLLYMFFGGSLAVCVWKCS NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggctgaaccagcagaaagcaagaaggaggaggccgactacaagagagtgcacagcttc cctctcgtccggcacacagacatgccagaggagatgagagtggagactatggagctctgt gtcactgcttgtgagaaatacgccacaaacaatgagaacgccgctaagatgatcaaggag tccatggataagaagttcggctcttcgtggcacgtagtgattggggagggcttcgggttc gaggtgacccacgaggtgaagaacctgctctacatgttcttcggagggagcctggccgtg tgcgtgtggaagtgctcctag

DBGET integrated database retrieval system