Acipenser ruthenus (sterlet): 117962373 Help Entry 117962373         CDS       T07327                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism arut  Acipenser ruthenus (sterlet) Pathway arut04382   Cornified envelope formation arut05132   Salmonella infection Brite KEGG Orthology (KO) [BR:arut00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     117962373  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117962373  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:arut04147]     117962373 Exosome [BR:arut04147]  Exosomal proteins   Exosomal proteins of microglial cells    117962373 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_8 EF-hand_6 EH DUF4378 NAAA-beta Motif Other DBs NCBI-GeneID:  117962373 NCBI-ProteinID:  XP_033850244 LinkDB All DBs Position 33:complement(1853563..1857021) Genome browser AA seq 100 aa AA seqDB search MPSELERCMESLITIFHKYAGKEGRANSLNKKELKELMTNELSSFLKSQKNPAAVDKIMK DLDQNGDGEVDFEEFVALVVGLSISCEQLFQVHLQKQGKK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgccttctgaactggaacgttgcatggagtccctcatcaccatcttccacaagtacgct ggcaaggagggccgtgccaactcactgaacaagaaggagctgaaagagctcatgaccaac gagctcagcagcttcctcaagagccagaagaacccagcggcggtggataagatcatgaag gatctggatcagaacggagacggggaggtggacttcgaggagtttgtggctctggtagtt ggtctgtccatctcctgtgagcagctcttccaagtccacctgcagaagcagggcaagaag tga

DBGET integrated database retrieval system