Acipenser ruthenus (sterlet): 117967914 Help Entry 117967914         CDS       T07327                                  Name (RefSeq) claudin-15-like   KO K06087   claudin Organism arut  Acipenser ruthenus (sterlet) Pathway arut03272   Virion - Hepatitis viruses arut04382   Cornified envelope formation arut04514   Cell adhesion molecules arut04530   Tight junction Brite KEGG Orthology (KO) [BR:arut00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     117967914  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     117967914  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     117967914  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     117967914  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:arut03037]     117967914    04147 Exosome [BR:arut04147]     117967914    04515 Cell adhesion molecules [BR:arut04515]     117967914 Cilium and associated proteins [BR:arut03037]  Other cilia and associated proteins   Stereociliary proteins    117967914 Exosome [BR:arut04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    117967914   Exosomal proteins of colorectal cancer cells    117967914 Cell adhesion molecules [BR:arut04515]  Immunoglobulin superfamily   L1 family    117967914 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Motif Other DBs NCBI-GeneID:  117967914 NCBI-ProteinID:  XP_034771263 LinkDB All DBs Position 56:2837391..2839677 Genome browser AA seq 155 aa AA seqDB search MDSAVEVVAFILGFIAWIMLGVCIPYGYWKVSTVDGSVITTSTIYENLWMSCASDSTGIH NCREFPSLLALSGYLQASRALMITALVAGTLGNVAAMVGLKCTKVGGDNYVFKGRVAGVG GVCYLVEGLCAMVAISWYAFNITREFFDPLYPGTK NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atggattctgccgtggaagtggtggcttttattctggggttcatcgcgtggataatgctg ggcgtttgtatcccttacggctactggaaagtgtccaccgtggacggcagtgtcatcacc acgtccacgatctacgagaatctgtggatgtcgtgcgcctcggactccaccggcattcac aactgcagagagttcccgtcgctgctcgccttgtccggttacttgcaggcgagccgcgcg ttgatgatcacggcgctggtcgccgggacgctgggtaacgtggcggccatggtggggctg aaatgcaccaaagtgggcggggacaactacgtcttcaaaggaagggtcgcgggagtgggc ggggtctgctaccttgtggaaggtctgtgcgcaatggtcgccatctcctggtacgccttt aacatcaccagggaatttttcgaccctttatatcccggaacaaagtaa

DBGET integrated database retrieval system