Acipenser ruthenus (sterlet): 117968291 Help Entry 117968291         CDS       T07327                                  Name (RefSeq) protein S100-G-like   KO K17274   protein S100-A10 Organism arut  Acipenser ruthenus (sterlet) Pathway arut04382   Cornified envelope formation arut05132   Salmonella infection Brite KEGG Orthology (KO) [BR:arut00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     117968291  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117968291  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:arut04147]     117968291 Exosome [BR:arut04147]  Exosomal proteins   Exosomal proteins of microglial cells    117968291 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 Motif Other DBs NCBI-GeneID:  117968291 NCBI-ProteinID:  XP_034771855 LinkDB All DBs Position Unknown AA seq 88 aa AA seqDB search MSGLQPLEKSLLEIIALFSRYAKKEGHTKTLSKREASELISKELPNFMGKCDPKNVPDLD GDGEMTFEEFTVMILTVANAFNEMINSY NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgtctggactgcagcctcttgagaagagcctcctggaaatcattgcgctcttcagcaga tacgccaagaaagaggggcacacgaaaacactgtccaagagggaggcttcagaactgatc agcaaggagctgcccaacttcatggggaaatgtgatcccaagaacgttcccgatttggat ggagatggtgaaatgacctttgaagaattcacagtgatgatcctgacggtggccaatgcc ttcaatgagatgatcaattcatactga

DBGET integrated database retrieval system