Acipenser ruthenus (sterlet): 117969551 Help Entry 117969551         CDS       T07327                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism arut  Acipenser ruthenus (sterlet) Pathway arut04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:arut00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     117969551  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:arut04121]     117969551    03400 DNA repair and recombination proteins [BR:arut03400]     117969551 Ubiquitin system [BR:arut04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      117969551    Cul5 complex      117969551 DNA repair and recombination proteins [BR:arut03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      117969551 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  117969551 NCBI-ProteinID:  XP_034773368 LinkDB All DBs Position Unknown AA seq 114 aa AA seqDB search MIRRHKTTIFTDAKESTTVFELKRIVEGILKRAPEDQRLYKDDQLLDDSKTLGDCGFTSQ TARPQAPATVALAFRINDDAFEQLRVDSFSSPPELPDVMKPQDSGSSANDQAVQ NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgattcgacgtcacaagacgaccattttcaccgatgcgaaggagtccacgacggtgttc gagctgaaacgcatcgtcgaggggattctcaagagggcgcccgaggaccagcggctctac aaggatgaccagttgcttgatgacagtaagactctgggtgattgcggcttcaccagccag accgccagaccgcaagctccggccaccgtggccttggccttcagaatcaacgatgatgcg ttcgagcagctcagagtggattcgttctccagcccccccgagctcccagacgtcatgaag ccgcaggattctggaagcagcgcaaatgaccaggccgtgcagtga

DBGET integrated database retrieval system