Acipenser ruthenus (sterlet): 117970423
Help
Entry
117970423 CDS
T07327
Name
(RefSeq) cardiotrophin-2-like
KO
K24382
cardiotrophin 2
Organism
arut
Acipenser ruthenus (sterlet)
Pathway
arut04060
Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:
arut00001
]
09130 Environmental Information Processing
09133 Signaling molecules and interaction
04060 Cytokine-cytokine receptor interaction
117970423
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04052 Cytokines and neuropeptides [BR:
arut04052
]
117970423
Cytokines and neuropeptides [BR:
arut04052
]
Cytokines
CSF and other factors
117970423
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
PRF
CNTF
Motif
Other DBs
NCBI-GeneID:
117970423
NCBI-ProteinID:
XP_034774102
LinkDB
All DBs
Position
Unknown
AA seq
171 aa
AA seq
DB search
MSAPLPVTSISQTYSLAVLLRTNTAQLLTTYLKYQGSPFSDRGLSDHGLQLTGLPVSAAS
FCAWRQQSVEERLGENFKAYSAYIEFLRLVTDDQTALNPTALDLLKLLRKTHSRIRMLIG
KLAGLMTGLGLTIPEVAVDRLPAGSLSASDWERKIRGYAVCLGLTNWLERT
NT seq
513 nt
NT seq
+upstream
nt +downstream
nt
atgtcggcgcctctgcccgttacttcaatctcccagacctactccctcgcagtcttactg
cgaaccaacacggcacagctcctcacaacatacctcaagtaccaaggcagtccattcagc
gatcgcggcctctccgaccacggtctacagttgaccggcctgcccgtctccgccgcttca
ttctgcgcttggcgacaacagagcgtcgaagagcgcctcggggaaaatttcaaggcttac
agcgcttatatcgaattcctacggctggtcacggacgaccaaaccgccttaaaccccacg
gcgctggacttgttgaagttactgcggaaaacccacagccgaattcggatgctaatcggg
aaactcgccggtttaatgaccggcctggggttgacaatccccgaggtggcggtagaccgg
cttcccgcgggctcgctgagcgcttcggattgggaaaggaaaatccggggatacgccgtt
tgtctgggactgaccaactggcttgagcggacc
DBGET
integrated database retrieval system