Arthrobacter alpinus A3: MB46_09485 Help Entry MB46_09485        CDS       T04228                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism arw  Arthrobacter alpinus A3 Pathway arw00998   Biosynthesis of various antibiotics arw01100   Metabolic pathways arw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:arw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MB46_09485    00074 Mycolic acid biosynthesis     MB46_09485   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MB46_09485 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Pro_sub2 Motif Other DBs NCBI-ProteinID:  ALV45683 UniProt:  A0A0U3PMV2 LinkDB All DBs Position 2152804..2153049 Genome browser AA seq 81 aa AA seqDB search MASNEEILAGLAEIVNEETGLAPEAVELEKSFTDDLDIDSISMMTIVVNAEEKFDVKIPD EEVKNLKTVGDAVSFIAGAQA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggctagcaacgaagaaatcctggctggtttggccgaaatcgttaacgaagagaccggt cttgcccccgaggccgttgaactagagaagtccttcacggatgacctggacatcgattcc atctccatgatgacgatcgtcgtcaacgccgaagagaagttcgacgtgaagatcccggac gaggaagtcaagaacctcaagaccgtcggcgacgctgtcagcttcatcgcaggcgcacag gcttaa

DBGET integrated database retrieval system