Arthrobacter alpinus A3: MB46_19975 Help Entry MB46_19975        CDS       T04228                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism arw  Arthrobacter alpinus A3 Pathway arw00998   Biosynthesis of various antibiotics arw01100   Metabolic pathways arw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:arw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MB46_19975    00074 Mycolic acid biosynthesis     MB46_19975   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MB46_19975 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ALV47945 LinkDB All DBs Position unnamed:185421..185666 Genome browser AA seq 81 aa AA seqDB search MEITALSVVDAIRSTMDELSHMGPNDSFADLDIDSLSLVEAGVILSNKFGVHVDEFELAD AGNAVAAATIIQEKLAIQTAA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggaaattactgctctgagcgttgttgatgcgatccgatccaccatggacgagctaagt cacatggggccaaacgactcgtttgccgatcttgacatcgactcactctccctcgtggag gcaggcgtgattctgagcaacaagttcggggtgcacgtggacgaattcgaattggctgac gcaggcaatgctgtcgccgcagcaacaatcattcaagagaagctggccattcagaccgcc gcatag

DBGET integrated database retrieval system