Arthrobacter sp. ZXY-2: ARZXY2_1091 Help Entry ARZXY2_1091       CDS       T05201                                  Symbol atpE Name (GenBank) ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism arx  Arthrobacter sp. ZXY-2 Pathway arx00190   Oxidative phosphorylation arx01100   Metabolic pathways Module arx_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:arx00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     ARZXY2_1091 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:arx00194]     ARZXY2_1091 (atpE) Photosynthesis proteins [BR:arx00194]  Photosystem and electron transport system   F-type ATPase [OT]    ARZXY2_1091 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C DUF4233 Motif Other DBs NCBI-ProteinID:  AOY70649 LinkDB All DBs Position 1141684..1141887 Genome browser AA seq 67 aa AA seqDB search MEGNLNLVGYGLSAIGGGIGVGLVFAAYINGVARQPEAQRVLQPIAFLGLALTEALAILG LVFAFVL NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggaaggcaatctcaacctcgtaggttacggtctgtccgcaatcggcggtggtatcggt gtgggtctcgtgttcgcggcttacatcaacggtgttgctcgtcagccggaagctcagcgc gtgctgcagccgatcgcattccttggtctggcactgaccgaagctcttgccatcctcggc ctcgtcttcgctttcgttctctag

DBGET integrated database retrieval system