Arthrobacter sp. YC-RL1: ATC04_04750 Help Entry ATC04_04750       CDS       T04187                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism ary  Arthrobacter sp. YC-RL1 Brite KEGG Orthology (KO) [BR:ary00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ary03032]     ATC04_04750    03036 Chromosome and associated proteins [BR:ary03036]     ATC04_04750    03400 DNA repair and recombination proteins [BR:ary03400]     ATC04_04750 DNA replication proteins [BR:ary03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     ATC04_04750 Chromosome and associated proteins [BR:ary03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     ATC04_04750 DNA repair and recombination proteins [BR:ary03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       ATC04_04750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF2267 Motif Other DBs NCBI-ProteinID:  ALQ29927 UniProt:  A0A9X0FGR3 LinkDB All DBs Position 1024658..1024942 Genome browser AA seq 94 aa AA seqDB search MAMNRSELVAAVAAKTENSQVAVNGVLDAVFDVFVEQISQGEKVSIPGWLAVERTDRAAR TGRNPQTGEAIEIPAGHSVKLTAGSKLKAAVAKK NT seq 285 nt NT seq  +upstreamnt  +downstreamnt ttggctatgaaccgtagcgaacttgttgccgctgttgcagcgaagaccgaaaactcccag gttgccgtcaacggtgttctggatgctgttttcgacgttttcgttgagcagatctcgcag ggcgagaaggtttcgatcccaggctggctggcagtggagcgcaccgaccgtgcagctcgc accggccgcaacccgcagaccggcgaagccatcgagattcctgccggccactcggtgaag ctgaccgctggttcgaagctgaaggccgctgtcgccaagaagtaa

DBGET integrated database retrieval system