Arthrobacter sp. YC-RL1: ATC04_08915 Help Entry ATC04_08915       CDS       T04187                                  Name (GenBank) NrdH-redoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism ary  Arthrobacter sp. YC-RL1 Brite KEGG Orthology (KO) [BR:ary00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     ATC04_08915 Enzymes [BR:ary01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      ATC04_08915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Thioredoxin GST_N_3 DUF3088 GST_N_2 CLIC-like_N RdDM_RDM1 Glrx-like BFA1_C Thioredoxin_9 Thioredoxin_7 CMAS Motif Other DBs NCBI-ProteinID:  ALQ30663 UniProt:  A0A9X0K214 LinkDB All DBs Position complement(1903968..1904246) Genome browser AA seq 92 aa AA seqDB search MSNELNLEKYVPAAGGVTMFTTSWCGYCRNLKRLMDQKGVAYTEVNIEEVEGTAQIVESF NNGNQTVPTLIFPDGTAATNPRIEEVVERVGA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgagcaacgaattgaaccttgagaagtacgttcctgccgccggcggagtcaccatgttc accaccagctggtgcggctactgccgcaacctgaagcgcctgatggaccagaagggcgtg gcctacaccgaggtgaatatcgaagaggtcgagggcaccgcgcagatcgtcgagtcgttc aacaacggcaaccagaccgtcccgaccctgatcttccccgacggcaccgctgcaaccaac ccgcgcatcgaggaagtcgtcgagcgcgtcggagcgtag

DBGET integrated database retrieval system