Aeromonas sanarellii: KXJ75_00645 Help Entry KXJ75_00645       CDS       T08465                                  Symbol zapB Name (GenBank) cell division protein ZapB   KO K09892   cell division protein ZapB Organism asaa  Aeromonas sanarellii Brite KEGG Orthology (KO) [BR:asaa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:asaa03036]     KXJ75_00645 (zapB) Chromosome and associated proteins [BR:asaa03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     KXJ75_00645 (zapB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB YabA DUF7491 DUF2046 NET2A Rab11-FIP3 HR1 TSC22 Nuf2_DHR10-like ADIP Uso1_p115_C DUF7603 Mod_r XRCC4_CC FliT DivIC K-box GAS TolA_bind_tri Spectrin NUDE_C bZIP_2 RIMB1_N CC_Bre1 ACBP4_C DUF2203 YciZ CCDC138_cc DUF6262 Herpes_UL6 Seadorna_VP6 bZIP_1 CtIP_N FlaC_arch Spc24 Cep57_MT_bd DUF244 Prominin Motif Other DBs NCBI-ProteinID:  QXW29788 LinkDB All DBs Position 138499..138708 Genome browser AA seq 69 aa AA seqDB search MSLEVLEQLESKVQSAVDNISLLKMELDELKEQNSKLQDENHQLRNEHVAWQERLRALLG KMDQMGDAI NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgtcactagaagtccttgagcaactcgaatccaaagtacaatccgctgtcgacaacatc tccctgctgaagatggagctggacgagctgaaagagcagaacagcaagctgcaagacgag aaccatcagctgcgcaacgagcacgtcgcctggcaagagcgtctgcgtgccctgctgggc aagatggaccagatgggcgatgccatctga

DBGET integrated database retrieval system