Aeromonas sanarellii: KXJ75_05115 Help Entry KXJ75_05115       CDS       T08465                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism asaa  Aeromonas sanarellii Pathway asaa01100   Metabolic pathways asaa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:asaa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KXJ75_05115   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KXJ75_05115 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QXW30518 LinkDB All DBs Position 1069339..1069593 Genome browser AA seq 84 aa AA seqDB search MQNLQREIKQLIIDSLNLEGLTPDDIDDQAPLFGDGLGLDSIDALELGLAIKGRYGIVLS ADDADTRRHFASVEALAALVQSQA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcaaaacctgcaacgagagataaagcaactcatcatcgacagcctcaatctggagggg ctgaccccggatgacatcgacgaccaggctcccctgtttggcgacggactgggtctggat tccatcgatgcgctggagctgggactagccatcaaggggcgttacggcatagtgctctcc gccgacgatgcggacacccgtcgccatttcgccagtgtcgaggccctggctgccctggtc cagtcccaggcctga

DBGET integrated database retrieval system