Aeromonas sanarellii: KXJ75_10080 Help Entry KXJ75_10080       CDS       T08465                                  Name (GenBank) DinI family protein   KO K12149   DNA-damage-inducible protein I Organism asaa  Aeromonas sanarellii Brite KEGG Orthology (KO) [BR:asaa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:asaa03400]     KXJ75_10080 DNA repair and recombination proteins [BR:asaa03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     KXJ75_10080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI MinE DUF7320 Motif Other DBs NCBI-ProteinID:  QXW31297 LinkDB All DBs Position 2089569..2089823 Genome browser AA seq 84 aa AA seqDB search MRLEIIIDRKHQIPTSTMEALRQELLKQLGERFPDLHVRVAPGSAMALTVSRASKEEKEL AEAMVQEVWENADSWMPEEEAVEA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcgcctggaaatcatcatcgacagaaaacaccagatccccacctcgaccatggaggct ctgcgtcaggagctgctcaagcaactgggcgagcggttccccgatctgcatgtgcgggtc gcgccgggcagcgccatggccctgacggtcagtcgcgccagcaaggaggagaaggagctg gccgaggccatggtgcaggaggtgtgggagaacgccgacagctggatgccggaagaagag gccgtggaggcctga

DBGET integrated database retrieval system