Alosa sapidissima (American shad): 121684486 Help Entry 121684486         CDS       T11137                                  Symbol dynll2a Name (RefSeq) dynein, light chain, LC8-type 2a   KO K10418   dynein light chain LC8-type Organism asad  Alosa sapidissima (American shad) Pathway asad04814   Motor proteins asad05132   Salmonella infection Brite KEGG Orthology (KO) [BR:asad00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     121684486 (dynll2a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121684486 (dynll2a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:asad03037]     121684486 (dynll2a)    04812 Cytoskeleton proteins [BR:asad04812]     121684486 (dynll2a) Cilium and associated proteins [BR:asad03037]  Motile cilia and associated proteins   Dynein arm    121684486 (dynll2a) Cytoskeleton proteins [BR:asad04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      121684486 (dynll2a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  121684486 NCBI-ProteinID:  XP_041920485 LinkDB All DBs Position 15:complement(12418915..12422241) Genome browser AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgacaggaaggctgtgatcaagaatgctgacatgtccgaggacatgcagcaggac gccgtggactgtgccacacaagcaatggagaagtacaacatcgagaaggacatcgctgcc tacatcaaaaaggagtttgacaagaagtacaaccccacatggcactgtatcgtgggcaga aacttcggcagctacgtcactcacgagacaaagcacttcatctacttctacttgggccaa gtggccatcctcctcttcaagtcgggctga

DBGET integrated database retrieval system