Alosa sapidissima (American shad): 121689622 Help Entry 121689622         CDS       T11137                                  Name (RefSeq) thioredoxin-like   KO K03671   thioredoxin Organism asad  Alosa sapidissima (American shad) Pathway asad04621   NOD-like receptor signaling pathway asad05132   Salmonella infection Brite KEGG Orthology (KO) [BR:asad00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     121689622  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121689622  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:asad03110]     121689622 Chaperones and folding catalysts [BR:asad03110]  Protein folding catalysts   Protein disulfide isomerase    121689622 SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 Thioredoxin_8 OST3_OST6 AhpC-TSA Redoxin Thioredoxin_7 DIM1 Thioredoxin_9 PedC-like A6-like_Thioredoxin-like_C Glutaredoxin TraF Motif Other DBs NCBI-GeneID:  121689622 NCBI-ProteinID:  XP_041925521 LinkDB All DBs Position 18 Genome browser AA seq 105 aa AA seqDB search MVRIVEDKDAFHRALREAGGKLVVVDFTATWCGPCQSIAPFFQSLSQKYTDVVFLKVDVD DTPDVAQECEIKCMPTFHFYKNGKKVDEFSGSNREKLEEKVNTLK NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggttcgtatcgtcgaagacaaggacgcattccatcgggccttgcgtgaggcaggtggc aagctggtagtggtcgatttcacagccacttggtgcggcccttgccaaagcatcgcaccc tttttccaatccttgtctcaaaagtacacagatgtggtgttcctcaaggtggatgtggat gacacaccggacgtagcacaggagtgtgagatcaaatgcatgccaacattccacttctat aagaatggcaaaaaggttgatgaattttctggttccaaccgggaaaagctggaagagaag gtcaacacacttaaatga

DBGET integrated database retrieval system