Alosa sapidissima (American shad): 121695280 Help Entry 121695280         CDS       T11137                                  Symbol s100a10a Name (RefSeq) protein S100-A10a   KO K17274   protein S100-A10 Organism asad  Alosa sapidissima (American shad) Pathway asad04382   Cornified envelope formation asad05132   Salmonella infection Brite KEGG Orthology (KO) [BR:asad00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     121695280 (s100a10a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121695280 (s100a10a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:asad04147]     121695280 (s100a10a) Exosome [BR:asad04147]  Exosomal proteins   Exosomal proteins of microglial cells    121695280 (s100a10a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_8 EF-hand_6 EF-hand_FSTL1 NNH2 SPARC_Ca_bdg Motif Other DBs NCBI-GeneID:  121695280 NCBI-ProteinID:  XP_041931915 LinkDB All DBs Position 21:7758501..7760831 Genome browser AA seq 101 aa AA seqDB search MPSDLEKAMETMIMVFHKYASKEGDNNSLSRRELKDLMENELSGFLKSQKDPATVDKIMK DLDANGDGQVSFEEFVSLVVGLSIACEQCYQMHLKKTGARK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgccatctgacctagagaaagcgatggagaccatgatcatggtgttccacaaatacgct tccaaggagggcgacaacaactcgctgagccgcagggagctcaaagacctcatggagaac gagctatctggcttcctcaagtctcagaaagaccctgccacagtggacaagatcatgaag gatctggacgctaacggcgacggccaagtgagctttgaggagtttgtgtctctggtggtt ggcctgtccatcgcctgtgaacagtgctatcagatgcatctcaagaaaacgggggccaga aagtga

DBGET integrated database retrieval system