Alosa sapidissima (American shad): 121697148 Help Entry 121697148         CDS       T11137                                  Name (RefSeq) calmodulin-1-like   KO K02183   calmodulin Organism asad  Alosa sapidissima (American shad) Pathway asad04020   Calcium signaling pathway asad04070   Phosphatidylinositol signaling system asad04114   Oocyte meiosis asad04218   Cellular senescence asad04261   Adrenergic signaling in cardiomyocytes asad04270   Vascular smooth muscle contraction asad04371   Apelin signaling pathway asad04625   C-type lectin receptor signaling pathway asad04744   Phototransduction asad04910   Insulin signaling pathway asad04912   GnRH signaling pathway asad04916   Melanogenesis Brite KEGG Orthology (KO) [BR:asad00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     121697148    04020 Calcium signaling pathway     121697148    04070 Phosphatidylinositol signaling system     121697148  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     121697148    04218 Cellular senescence     121697148  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     121697148   09152 Endocrine system    04910 Insulin signaling pathway     121697148    04912 GnRH signaling pathway     121697148    04916 Melanogenesis     121697148   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     121697148    04270 Vascular smooth muscle contraction     121697148   09157 Sensory system    04744 Phototransduction     121697148  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:asad01009]     121697148   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:asad04131]     121697148    03036 Chromosome and associated proteins [BR:asad03036]     121697148   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:asad04147]     121697148 Protein phosphatases and associated proteins [BR:asad01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      121697148 Membrane trafficking [BR:asad04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     121697148 Chromosome and associated proteins [BR:asad03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      121697148 Exosome [BR:asad04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    121697148 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 CFAP251_C EF-hand_FSTL1 EH Allatotropin-like_C EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 SAPC2_N EFhand_Ca_insen Dockerin_1 EF-hand_EFHB_C BamM_C FCaBP_EF-hand DUF5580_M Caleosin DUF1103 TerB SPEF2_C EF-hand_STIM1 SurA_N_3 PA_Ig-like Motif Other DBs NCBI-GeneID:  121697148 NCBI-ProteinID:  XP_041934416 LinkDB All DBs Position 22:complement(27068779..27073479) Genome browser AA seq 178 aa AA seqDB search MYNRQGGSEFTDVHTFVSVAECGAPSSLKMADQLTEEQIAEFKEAFSLFDKDGDGTITTK ELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFR VFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atgtacaaccgtcaaggcgggtctgagtttaccgacgttcatacatttgtgtctgtggcg gagtgtggagccccgagtagtttgaaaatggctgatcaactgacagaggaacagatcgct gaattcaaagaggcattctcgttattcgacaaagatggcgatggcaccatcaccaccaaa gaactgggcacagtcatgcgctcgctgggccagaacccaacagaggcagagctgcaggac atgatcaatgaggtggatgctgatggtaacggaacaatagacttccctgaatttctgacc atgatggcaaggaagatgaaggacactgatagtgaagaggagatcagagaagccttccgt gtatttgacaaggatggcaacggctacatcagcgctgcagagctgcgtcacgtcatgacc aacttgggagagaagctgacagatgaggaggtcgacgagatgattagagaagctgacatt gacggagatggccaagtcaactatgaagagtttgtacagatgatgacagcgaaatga

DBGET integrated database retrieval system