Alosa sapidissima (American shad): 121705812 Help Entry 121705812         CDS       T11137                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism asad  Alosa sapidissima (American shad) Pathway asad04010   MAPK signaling pathway asad04137   Mitophagy - animal asad04140   Autophagy - animal asad04218   Cellular senescence asad04371   Apelin signaling pathway asad04625   C-type lectin receptor signaling pathway asad04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:asad00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121705812 (rras)    04371 Apelin signaling pathway     121705812 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     121705812 (rras)    04137 Mitophagy - animal     121705812 (rras)   09143 Cell growth and death    04218 Cellular senescence     121705812 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     121705812 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     121705812 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:asad04147]     121705812 (rras)    04031 GTP-binding proteins [BR:asad04031]     121705812 (rras) Exosome [BR:asad04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    121705812 (rras)   Exosomal proteins of bladder cancer cells    121705812 (rras) GTP-binding proteins [BR:asad04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     121705812 (rras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 Motif Other DBs NCBI-GeneID:  121705812 NCBI-ProteinID:  XP_041942990 LinkDB All DBs Position 3:24210873..24216973 Genome browser AA seq 197 aa AA seqDB search MSSEEERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGTETRLDIL DTAGQEEFGAMREQYMRSGEGFLLVFALNDRGSYNEIQKFHTQILRVKDRDDFPMVLVGN KSDLDQHRVISREEAQAFARENRIYYMESSAKNRYNVDEAFLEVVRAIRKFQETESPPLP ANHSGKQKSSGCPCSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgtcctctgaagaggaaagattcaagttggtagtcgtgggcggtggcggtgtgggaaaa agcgcactgaccattcagttcatccagtcatattttgtatcagactatgacccaactatt gaagactcttacactaaaatctgcactgttgacgggactgagacgcggctggacattcta gacacagctggtcaggaggagtttggtgctatgagggagcagtacatgcgctcaggagag ggattcttactagtgtttgccctgaatgatcggggcagttacaacgagatccagaagttc cacacccagattctgcgagtgaaagatcgtgatgacttccccatggttttagttggtaac aagtcagaccttgaccagcacagagtgatatccagagaggaggcacaggcttttgcccgg gaaaatcggatctactacatggagtcctccgctaagaaccgttacaatgtggatgaggct ttcttggaggttgtgagggcaatcaggaagttccaggagacagaaagtccacctcttcct gccaaccattcaggcaaacagaagagcagtggatgcccatgcagtatcctctaa

DBGET integrated database retrieval system