Alosa sapidissima (American shad): 121708715 Help Entry 121708715         CDS       T11137                                  Name (RefSeq) cystatin-B-like   KO K13907   cystatin-A/B Organism asad  Alosa sapidissima (American shad) Brite KEGG Orthology (KO) [BR:asad00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:asad01002]     121708715   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:asad04147]     121708715 Peptidases and inhibitors [BR:asad01002]  Peptidase inhibitors   Family I25: cystatin family    121708715 Exosome [BR:asad04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    121708715 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Dynein_light DUF4600 Motif Other DBs NCBI-GeneID:  121708715 NCBI-ProteinID:  XP_041947481 LinkDB All DBs Position 5:10278326..10280193 Genome browser AA seq 100 aa AA seqDB search MPMMRGGTSEQKPATPEIQAICDEMKPHVEEKAEQKYDVFTATHYASQVVAGTNYFIKVH VGGDDHIHIRVFQSLPHAGLKKELHSLQKDKTQQDPVTYF NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgccgatgatgcgcggaggaaccagcgagcagaaacctgccactcctgagatccaggca atctgtgacgagatgaagcctcatgttgaagagaaagctgaacagaagtatgacgtcttt acagccacacactacgcatcccaagtggtggctggaaccaactacttcatcaaggtgcat gtgggtggagatgaccacatccacatccgtgtgttccagagccttccccacgctggcctt aagaaggagctccacagcctgcagaaagacaagacccagcaggacccagtcacttacttc taa

DBGET integrated database retrieval system