Alosa sapidissima (American shad): 121718375 Help Entry 121718375         CDS       T11137                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism asad  Alosa sapidissima (American shad) Pathway asad03082   ATP-dependent chromatin remodeling asad04217   Necroptosis Brite KEGG Orthology (KO) [BR:asad00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     121718375  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     121718375  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:asad03036]     121718375   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:asad04147]     121718375 Chromosome and associated proteins [BR:asad03036]  Eukaryotic type   Nucleosome assembly factors    Histones     121718375 Exosome [BR:asad04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121718375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  121718375 NCBI-ProteinID:  XP_041959342 LinkDB All DBs Position 9:15038313..15039187 Genome browser AA seq 125 aa AA seqDB search MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKSK NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atgagcggcagaggcaaaaccggtggcaaggccagagcaaaggccaagactcgttcatcc agggctggacttcagttccccgtgggccgtgtccacaggctgttgcgtaaaggcaactat gctcagcgtgtcggcgctggtgcaccagtctatttggctgctgtgctcgagtacctgact gctgagatcctggagttggccggcaacgctgcccgtgacaacaagaagacccgtatcatt ccccgccatctgcagctggctgtgcgtaacgacgaggagttgaacaagctgctcggcgga gtgaccatcgctcagggtggtgtactgcctaacatccaggctgtgctgctgcccaagaag actgagaagtccaagtaa

DBGET integrated database retrieval system