Alosa sapidissima (American shad): 121720782 Help Entry 121720782         CDS       T11137                                  Symbol cdc42l Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism asad  Alosa sapidissima (American shad) Pathway asad04010   MAPK signaling pathway asad04144   Endocytosis asad04370   VEGF signaling pathway asad04510   Focal adhesion asad04517   IgSF CAM signaling asad04518   Integrin signaling asad04520   Adherens junction asad04530   Tight junction asad04810   Regulation of actin cytoskeleton asad04912   GnRH signaling pathway asad05100   Bacterial invasion of epithelial cells asad05132   Salmonella infection Brite KEGG Orthology (KO) [BR:asad00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121720782 (cdc42l)    04370 VEGF signaling pathway     121720782 (cdc42l)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     121720782 (cdc42l)    04518 Integrin signaling     121720782 (cdc42l)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     121720782 (cdc42l)   09144 Cellular community - eukaryotes    04510 Focal adhesion     121720782 (cdc42l)    04520 Adherens junction     121720782 (cdc42l)    04530 Tight junction     121720782 (cdc42l)   09142 Cell motility    04810 Regulation of actin cytoskeleton     121720782 (cdc42l)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     121720782 (cdc42l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121720782 (cdc42l)    05100 Bacterial invasion of epithelial cells     121720782 (cdc42l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:asad04131]     121720782 (cdc42l)    03036 Chromosome and associated proteins [BR:asad03036]     121720782 (cdc42l)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:asad04147]     121720782 (cdc42l)    04031 GTP-binding proteins [BR:asad04031]     121720782 (cdc42l) Membrane trafficking [BR:asad04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     121720782 (cdc42l)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     121720782 (cdc42l)   Macropinocytosis    Ras GTPases     121720782 (cdc42l) Chromosome and associated proteins [BR:asad03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     121720782 (cdc42l) Exosome [BR:asad04147]  Exosomal proteins   Exosomal proteins of microglial cells    121720782 (cdc42l)   Exosomal proteins of breast milk    121720782 (cdc42l) GTP-binding proteins [BR:asad04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     121720782 (cdc42l) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  121720782 NCBI-ProteinID:  XP_041963145 LinkDB All DBs Position 10:28987430..28998799 Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVREKWVPEISHHCPRTPFLLVGTQMDLR DDSNTVEKLAKNKQRPISPESGDKLARELRAVKYVECSALTQRGLKNVFDEAILAALEPP ETKPKKRCMLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagaccataaagtgtgtagtggtgggggatggtgctgtggggaagacatgccttctg atctcttacaccacgaacaagttcccgtctgaatatgttcccacggtgttcgataactat gcggtgacggtgatgatcggaggggaaccatacacactgggactctttgacacagcaggt caggaggactacgacagactgcggcccctcagctacccccagactgacgtcttcctcgtc tgtttctctgtggtctccccctcctcttttgagaacgtcagggaaaaatgggtgccagag atctctcaccactgccctcgcacgcccttcctgctggtgggaactcagatggacctgcgg gacgacagcaacacagtggagaagctggccaagaacaagcagcggcccatatcccccgag agcggcgacaagctggcacgagagctcagagccgtcaaatacgtggagtgctccgccctt acacagagggggctgaaaaacgtgtttgacgaggccatcttggctgccttggagcctccc gagaccaaacccaagaagcgctgcatgctgctataa

DBGET integrated database retrieval system