Alosa sapidissima (American shad): 121723475 Help Entry 121723475         CDS       T11137                                  Symbol kras Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism asad  Alosa sapidissima (American shad) Pathway asad04010   MAPK signaling pathway asad04012   ErbB signaling pathway asad04068   FoxO signaling pathway asad04137   Mitophagy - animal asad04140   Autophagy - animal asad04150   mTOR signaling pathway asad04210   Apoptosis asad04218   Cellular senescence asad04370   VEGF signaling pathway asad04371   Apelin signaling pathway asad04540   Gap junction asad04625   C-type lectin receptor signaling pathway asad04810   Regulation of actin cytoskeleton asad04910   Insulin signaling pathway asad04912   GnRH signaling pathway asad04914   Progesterone-mediated oocyte maturation asad04916   Melanogenesis Brite KEGG Orthology (KO) [BR:asad00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121723475 (kras)    04012 ErbB signaling pathway     121723475 (kras)    04370 VEGF signaling pathway     121723475 (kras)    04371 Apelin signaling pathway     121723475 (kras)    04068 FoxO signaling pathway     121723475 (kras)    04150 mTOR signaling pathway     121723475 (kras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     121723475 (kras)    04137 Mitophagy - animal     121723475 (kras)   09143 Cell growth and death    04210 Apoptosis     121723475 (kras)    04218 Cellular senescence     121723475 (kras)   09144 Cellular community - eukaryotes    04540 Gap junction     121723475 (kras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     121723475 (kras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     121723475 (kras)   09152 Endocrine system    04910 Insulin signaling pathway     121723475 (kras)    04912 GnRH signaling pathway     121723475 (kras)    04914 Progesterone-mediated oocyte maturation     121723475 (kras)    04916 Melanogenesis     121723475 (kras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:asad04131]     121723475 (kras)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:asad04031]     121723475 (kras) Membrane trafficking [BR:asad04131]  Endocytosis   Macropinocytosis    Ras GTPases     121723475 (kras) GTP-binding proteins [BR:asad04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     121723475 (kras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin AAA_16 Motif Other DBs NCBI-GeneID:  121723475 NCBI-ProteinID:  XP_041965125 LinkDB All DBs Position 11:complement(33781955..33791987) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQHRLQKLSKEEKTPRC IKLKKCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagagtacaagctggtggtggtgggagctggtggcgttggcaagagtgcgctcacc atccagctcatccagaaccactttgtggacgaatacgaccccaccatagaggactcctac aggaagcaggtggtgattgacggggagacgtgtctgctggacatcttggacactgcaggt caggaagagtacagcgccatgagggaccagtacatgaggacaggggagggcttcctctgt gtctttgccatcaacaacaccaagtcctttgaggacattcatcactatagagagcagata aagagagtgaaggactccgaggacgtccccatggtcctggtggggaacaagtgtgacctc ccgtcccgcaccgtggacaccaaacaggcccaggacctggcccgcagttacgggatcccg ttcatcgagacgtcagccaagacgagacagagagtggaggatgccttttacactctggta cgggagatcagacagcatcggctgcaaaagctcagcaaggaagaaaagactccacgctgc atcaagctaaaaaaatgtgttgtgatgtga

DBGET integrated database retrieval system