Alosa sapidissima (American shad): 121723566 Help Entry 121723566         CDS       T11137                                  Symbol hrasa Name (RefSeq) HRas proto-oncogene, GTPase a   KO K02833   GTPase HRas Organism asad  Alosa sapidissima (American shad) Pathway asad04010   MAPK signaling pathway asad04012   ErbB signaling pathway asad04068   FoxO signaling pathway asad04137   Mitophagy - animal asad04140   Autophagy - animal asad04144   Endocytosis asad04150   mTOR signaling pathway asad04210   Apoptosis asad04218   Cellular senescence asad04370   VEGF signaling pathway asad04371   Apelin signaling pathway asad04510   Focal adhesion asad04519   Cadherin signaling asad04540   Gap junction asad04625   C-type lectin receptor signaling pathway asad04810   Regulation of actin cytoskeleton asad04910   Insulin signaling pathway asad04912   GnRH signaling pathway asad04916   Melanogenesis asad05132   Salmonella infection Brite KEGG Orthology (KO) [BR:asad00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121723566 (hrasa)    04012 ErbB signaling pathway     121723566 (hrasa)    04370 VEGF signaling pathway     121723566 (hrasa)    04371 Apelin signaling pathway     121723566 (hrasa)    04068 FoxO signaling pathway     121723566 (hrasa)    04150 mTOR signaling pathway     121723566 (hrasa)   09133 Signaling molecules and interaction    04519 Cadherin signaling     121723566 (hrasa)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     121723566 (hrasa)    04140 Autophagy - animal     121723566 (hrasa)    04137 Mitophagy - animal     121723566 (hrasa)   09143 Cell growth and death    04210 Apoptosis     121723566 (hrasa)    04218 Cellular senescence     121723566 (hrasa)   09144 Cellular community - eukaryotes    04510 Focal adhesion     121723566 (hrasa)    04540 Gap junction     121723566 (hrasa)   09142 Cell motility    04810 Regulation of actin cytoskeleton     121723566 (hrasa)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     121723566 (hrasa)   09152 Endocrine system    04910 Insulin signaling pathway     121723566 (hrasa)    04912 GnRH signaling pathway     121723566 (hrasa)    04916 Melanogenesis     121723566 (hrasa)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121723566 (hrasa)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:asad04131]     121723566 (hrasa)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:asad04147]     121723566 (hrasa)    04031 GTP-binding proteins [BR:asad04031]     121723566 (hrasa) Membrane trafficking [BR:asad04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     121723566 (hrasa)  Endocytosis   Macropinocytosis    Ras GTPases     121723566 (hrasa) Exosome [BR:asad04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    121723566 (hrasa)   Exosomal proteins of colorectal cancer cells    121723566 (hrasa) GTP-binding proteins [BR:asad04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     121723566 (hrasa) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin DUF6974 Ldh_1_N Motif Other DBs NCBI-GeneID:  121723566 NCBI-ProteinID:  XP_041965290 LinkDB All DBs Position 11:29721444..29736823 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CLSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaagctggtggtagtgggagctggtggcgttggcaagagtgcgctcacc atccagctcatccagaaccactttgtggacgaatacgaccccaccatagaggactcctac aggaaacaggtggtgattgacggggagacgtgtctgctggacatcttggacactgcaggt caggaggagtacagcgccatgagggaccagtacatgaggacaggggagggcttcctctgt gtctttgccatcaacaacaccaagtccttcgaagacattcaccagtacagggaacagatc aaacgggtgaaggactcggacgatgtgcccatggtgcttgtgggtaataagtgtgacctg cccgctcggacagtcgacacgcggcaggcacaggagctcgcccgcagctacggcatcccc tacattgagacgtcggccaagacccgtcagggagtggaggacgccttctacacactggtg cgtgagattcgacagcacaaattaagaaagctgaacccgccggacgagagtggacaagac tgcctgagctgccgctgcgtggtgtcttga

DBGET integrated database retrieval system