Agrobacterium salinitolerans: CFBP5507_03625 Help Entry CFBP5507_03625    CDS       T08921                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism asal  Agrobacterium salinitolerans Pathway asal01100   Metabolic pathways asal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:asal00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CFBP5507_03625    00074 Mycolic acid biosynthesis     CFBP5507_03625   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CFBP5507_03625 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Delta_lysin Motif Other DBs NCBI-ProteinID:  UYZ08111 UniProt:  A0A1S9F144 LinkDB All DBs Position Circular:738593..738829 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDADKVVEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgtaaagaaaattgtaattgatcatcttggcgttgacgcc gacaaggttgtcgaaggcgccagcttcattgacgatctgggcgctgattcgctcgacacc gttgaactggtcatggctttcgaagaagaattcggcgttgaaatccccgacgacgcagct gactcgatcctgacggtcggcgacgccgtcaagttcatcgagaaggcccaggcctga

DBGET integrated database retrieval system