Aerococcus sanguinicola: AWM72_01780 Help Entry AWM72_01780       CDS       T04253                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism asan  Aerococcus sanguinicola Pathway asan01100   Metabolic pathways asan01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:asan00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AWM72_01780    00074 Mycolic acid biosynthesis     AWM72_01780   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AWM72_01780 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 ACP_SdgA_C CorC_HlyC TRI4_N Motif Other DBs NCBI-ProteinID:  AMB93567 UniProt:  A0A0X8FA62 LinkDB All DBs Position complement(357751..358002) Genome browser AA seq 83 aa AA seqDB search MEVELKVFQMIIDRYGVEAERVSRDLSFTDDLGADSLDVVELIMELEDIFGIQIPDDKVE SIETVGDVLDYIRDNVPSAEDKA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggaagtggagttaaaagtctttcaaatgatcattgaccgctacggagtggaagccgaa cgcgtcagccgggacctgtccttcactgacgatctcggcgccgactcccttgacgtggtg gaattgattatggaactcgaagacatcttcggcatccagatccccgatgacaaagtggag tcgattgaaacggtgggggatgtcctcgattacatccgcgataatgtcccctcagccgaa gataaagcctga

DBGET integrated database retrieval system