Anolis sagrei ordinatus (Brown anole): 132767843 Help Entry 132767843         CDS       T09595                                  Name (RefSeq) ras-related protein Rab-7a-like   KO K07897   Ras-related protein Rab-7A Organism asao  Anolis sagrei ordinatus (Brown anole) Pathway asao04137   Mitophagy - animal asao04140   Autophagy - animal asao04144   Endocytosis asao04145   Phagosome asao04148   Efferocytosis asao05132   Salmonella infection Brite KEGG Orthology (KO) [BR:asao00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     132767843    04145 Phagosome     132767843    04140 Autophagy - animal     132767843    04137 Mitophagy - animal     132767843    04148 Efferocytosis     132767843  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     132767843  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:asao04131]     132767843   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:asao04147]     132767843    04031 GTP-binding proteins [BR:asao04031]     132767843 Membrane trafficking [BR:asao04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     132767843 Exosome [BR:asao04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    132767843   Exosomal proteins of other body fluids (saliva and urine)    132767843   Exosomal proteins of colorectal cancer cells    132767843   Exosomal proteins of bladder cancer cells    132767843 GTP-binding proteins [BR:asao04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     132767843 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase cobW AIG1 PduV-EutP AAA_7 AAA_16 AAA_29 AAA_22 FeoB_N MCM Septin CNTF AAA_33 G-alpha ABC_tran ATPase_2 AAA Motif Other DBs NCBI-GeneID:  132767843 NCBI-ProteinID:  XP_060619185 LinkDB All DBs Position Unknown AA seq 200 aa AA seqDB search MFRRSHIKILLIGNSGAGKSALMNQYVNNRFSSRYRATIGSDFLSKQVHIDGRTLTVQIW DTAGTERFQALGTALYRGSDCCLLVFDVTSPSSFQALDKWHKQLLFQIEEQSAFPIAVIG NKTDLENREVSLEEAELWSRLHHATYFETSAKAATNVQEVFQWAVRAGLKNRRISELPEP DSVRLETRPAEGAHRDKCGC NT seq 603 nt NT seq  +upstreamnt  +downstreamnt atgttcagacgctcacacatcaaaatcctcctgattgggaattcaggggctggcaaatct gccctgatgaaccagtatgtaaacaaccgcttcagcagccgctatcgagccactattggg tctgacttcctcagcaaacaagttcacattgatgggcgtacactgacggtacagatctgg gacacggccggcacagagcggttccaagctctggggactgccctgtaccgggggtcagac tgctgcctcctcgtctttgacgtcacgtctcccagctctttccaggccctggacaagtgg cacaagcagcttttgtttcagattgaggaacagtctgcattccccatcgctgtcatcggg aacaagaccgaccttgagaatcgagaggtctcgttagaggaagctgaattgtggagcaga cttcaccatgccacgtacttcgaaaccagtgccaaggctgccaccaacgtacaagaagtg tttcagtgggcggtacgggcaggcctaaaaaatcgcaggatatctgaactgccagaacca gactctgtccgcttggagactaggccagcagaaggggcacacagagataaatgtggctgc tga

DBGET integrated database retrieval system