Anolis sagrei ordinatus (Brown anole): 132768169 Help Entry 132768169         CDS       T09595                                  Name (RefSeq) histone H2A type 2-C-like   KO K11251   histone H2A Organism asao  Anolis sagrei ordinatus (Brown anole) Pathway asao03082   ATP-dependent chromatin remodeling asao04217   Necroptosis Brite KEGG Orthology (KO) [BR:asao00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     132768169  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     132768169  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:asao03036]     132768169   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:asao04147]     132768169 Chromosome and associated proteins [BR:asao03036]  Eukaryotic type   Nucleosome assembly factors    Histones     132768169 Exosome [BR:asao04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    132768169 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  132768169 NCBI-ProteinID:  XP_060619809 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TESHKAKGK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtccggccgtggcaaacaaggaggcaaagcgagggcgaaggcgaagtctcgctcttcc agggcagggctccagttccccgtcggccgtgtccaccgccttctccgcaaagggaactac gccgaaagggtgggagccggggccccggtttacctggccgcggtgctggagtacctgacg gccgagatcctggagttagctggcaacgcggctcgtgacaataagaagacccgtatcatc ccccgccacttgcagctggccgttcgcaacgacgaggagctgaacaagctcttgggggga gtgaccatcgcccagggcggagtcctgcccaacatccaggccgtgctcttgcccaagaag accgagagccacaaggccaaaggcaaatga

DBGET integrated database retrieval system