Anolis sagrei ordinatus (Brown anole): 132769312 Help Entry 132769312         CDS       T09595                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism asao  Anolis sagrei ordinatus (Brown anole) Pathway asao04137   Mitophagy - animal asao04140   Autophagy - animal asao04144   Endocytosis asao04145   Phagosome asao04148   Efferocytosis asao05132   Salmonella infection Brite KEGG Orthology (KO) [BR:asao00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     132769312 (RAB7A)    04145 Phagosome     132769312 (RAB7A)    04140 Autophagy - animal     132769312 (RAB7A)    04137 Mitophagy - animal     132769312 (RAB7A)    04148 Efferocytosis     132769312 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     132769312 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:asao04131]     132769312 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:asao04147]     132769312 (RAB7A)    04031 GTP-binding proteins [BR:asao04031]     132769312 (RAB7A) Membrane trafficking [BR:asao04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     132769312 (RAB7A) Exosome [BR:asao04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    132769312 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    132769312 (RAB7A)   Exosomal proteins of colorectal cancer cells    132769312 (RAB7A)   Exosomal proteins of bladder cancer cells    132769312 (RAB7A) GTP-binding proteins [BR:asao04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     132769312 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 AAA_14 NACHT NB-ARC ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  132769312 NCBI-ProteinID:  XP_060622158 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacttctagaaagaaagtattactcaaagtcatcatccttggagattcaggggtggga aagacatctcttatgaaccagtatgtgaacaagaaattcagtaaccagtacaaagctaca ataggagctgacttcctgacgaaagaggtgatggtggatgataggctagtcacaatgcag atatgggatacagcagggcaggaacgatttcagtcccttggagttgctttttaccgaggc gcagactgctgcgtgctggtgtttgacgtaacggctcccaacacatttaaaactcttgac agctggcgagatgagttcctcattcaagcaagtccacgggatcctgagaactttcctttt gttgtgctgggaaacaaaattgacctagaaaacagacaagtcactacaaaacgagcacag gcctggtgctacagcaaaaacaatatcccttactttgaaaccagtgccaaggaagccatt aacgtggagcaggctttccagacaattgcacggaatgcacttaaacaggaaactgaagtg gagctttacaatgaatttcctgaacccatcaaactagacaagaacgaccgagcaaaggcc tctgcggagagctgcagctgctga

DBGET integrated database retrieval system