Anolis sagrei ordinatus (Brown anole): 132770484 Help Entry 132770484         CDS       T09595                                  Symbol RRAS2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism asao  Anolis sagrei ordinatus (Brown anole) Pathway asao04010   MAPK signaling pathway asao04137   Mitophagy - animal asao04140   Autophagy - animal asao04218   Cellular senescence asao04371   Apelin signaling pathway asao04625   C-type lectin receptor signaling pathway asao04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:asao00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     132770484 (RRAS2)    04371 Apelin signaling pathway     132770484 (RRAS2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     132770484 (RRAS2)    04137 Mitophagy - animal     132770484 (RRAS2)   09143 Cell growth and death    04218 Cellular senescence     132770484 (RRAS2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     132770484 (RRAS2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     132770484 (RRAS2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:asao04147]     132770484 (RRAS2)    04031 GTP-binding proteins [BR:asao04031]     132770484 (RRAS2) Exosome [BR:asao04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    132770484 (RRAS2)   Exosomal proteins of bladder cancer cells    132770484 (RRAS2) GTP-binding proteins [BR:asao04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     132770484 (RRAS2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 RsgA_GTPase Motif Other DBs NCBI-GeneID:  132770484 NCBI-ProteinID:  XP_060623454 LinkDB All DBs Position Unknown AA seq 203 aa AA seqDB search MAAGCRDGPGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERA ARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDKGSFEEIYKFQRQILRVKDRDEFP MILVGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRLNVDQAFHELVRVVRKFQEQ ECPPSPEPTRKEKDKKGCHCVIF NT seq 612 nt NT seq  +upstreamnt  +downstreamnt atggccgcgggctgcagggacggcccggggcaggagaagtaccggctggtggtggtgggc ggcggcggcgtgggcaagtccgcgctcaccatccagttcatccagtcctactttgtcaca gactatgatccaacaattgaagactcctacacaaagcaatgtgtaatagacgagagggca gcaagattggatatcctagatacagcagggcaagaagaatttggggccatgcgggagcag tacatgaggacaggagaaggctttctgcttgtcttctcggtcacagataaaggaagcttt gaagaaatttacaagtttcaaagacagattcttagagtaaaagaccgagatgaattcccc atgatcctagttggtaacaaagcagacctggaccatcaaagacaggtaacacaagaggaa gggcagcagttagcacgacagctgaaagtaacatatatggaagcatcagcaaaaatacga ctgaatgtagaccaagcttttcatgaacttgtcagagttgttaggaaatttcaagaacaa gaatgccctccttctccagagccaacaaggaaggaaaaggacaagaaagggtgccattgt gttatcttctaa

DBGET integrated database retrieval system