Anolis sagrei ordinatus (Brown anole): 132771520 Help Entry 132771520         CDS       T09595                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism asao  Anolis sagrei ordinatus (Brown anole) Pathway asao04010   MAPK signaling pathway asao04012   ErbB signaling pathway asao04068   FoxO signaling pathway asao04137   Mitophagy - animal asao04140   Autophagy - animal asao04144   Endocytosis asao04150   mTOR signaling pathway asao04210   Apoptosis asao04218   Cellular senescence asao04370   VEGF signaling pathway asao04371   Apelin signaling pathway asao04510   Focal adhesion asao04540   Gap junction asao04625   C-type lectin receptor signaling pathway asao04810   Regulation of actin cytoskeleton asao04910   Insulin signaling pathway asao04912   GnRH signaling pathway asao04916   Melanogenesis asao05132   Salmonella infection Brite KEGG Orthology (KO) [BR:asao00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     132771520 (HRAS)    04150 mTOR signaling pathway     132771520 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     132771520 (HRAS)    04140 Autophagy - animal     132771520 (HRAS)    04137 Mitophagy - animal     132771520 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:asao04131]     132771520 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:asao04147]     132771520 (HRAS)    04031 GTP-binding proteins [BR:asao04031]     132771520 (HRAS) Membrane trafficking [BR:asao04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     132771520 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     132771520 (HRAS) Exosome [BR:asao04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    132771520 (HRAS)   Exosomal proteins of colorectal cancer cells    132771520 (HRAS) GTP-binding proteins [BR:asao04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     132771520 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N AAA_16 CbiA Motif Other DBs NCBI-GeneID:  132771520 NCBI-ProteinID:  XP_060625629 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagagtacaagctggtggtggttggtgctggaggtgtggggaagagtgctttgacc attcagctaatccagaaccattttgttgatgaatatgatcccacgatagaggactcctac agaaagcaagtggtcatcgatggagaaacctgtttgctagacatccttgacacagcaggc caagaggagtacagtgctatgcgagaccaatacatgcggactggagaaggttttctttgt gtctttgccattaacaacaccaagtcctttgaagacattcatcagtacagggagcaaatc aagagggtgaaagattctgatgatgtccccatggtgctggtaggaaataaatgtgacctt ccagcccggaccgtggaaacgcgacaagcccaggaactggctcggagctatgggattccc tacattgagacatcagccaaaaccagacagggagttgaagatgccttctatactttagtg cgggagatccggcagcacaaactacgcaaattgaatcctccagatgaaagtggcccaggc tgtatgaattgtaaatgtgtaatatcatga

DBGET integrated database retrieval system