Anolis sagrei ordinatus (Brown anole): 132773198 Help Entry 132773198         CDS       T09595                                  Symbol POLD4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism asao  Anolis sagrei ordinatus (Brown anole) Pathway asao03030   DNA replication asao03410   Base excision repair asao03420   Nucleotide excision repair asao03430   Mismatch repair asao03440   Homologous recombination Brite KEGG Orthology (KO) [BR:asao00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     132773198 (POLD4)    03410 Base excision repair     132773198 (POLD4)    03420 Nucleotide excision repair     132773198 (POLD4)    03430 Mismatch repair     132773198 (POLD4)    03440 Homologous recombination     132773198 (POLD4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:asao03032]     132773198 (POLD4)    03400 DNA repair and recombination proteins [BR:asao03400]     132773198 (POLD4) DNA replication proteins [BR:asao03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     132773198 (POLD4) DNA repair and recombination proteins [BR:asao03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       132773198 (POLD4)    MMR (mismatch excision repair)     DNA polymerase delta complex      132773198 (POLD4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_pol_delta_4 MCD_N Motif Other DBs NCBI-GeneID:  132773198 NCBI-ProteinID:  XP_060628202 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MGRKRLITDSFQVVKKRKRGRKEGKECQTPTHDTAQAESSLQDAAQPDQVELLKHFDLSW EYGPCTGITRWQRWERAELLGLHPPATVKELLLKYSKDPLVIHSVWYEYSL NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atgggtaggaagcgactcatcacagactcattccaagtggtgaagaaaaggaaaagaggg aggaaagaaggaaaggaatgccaaaccccaacccatgacacagcccaggcagaatcttcc ttgcaagatgctgcacagccagaccaagtggagttactgaagcattttgacctcagctgg gaatatggtccttgcacaggaatcacccgttggcagcgctgggagagagcagagttgttg ggtctccatccccctgccaccgtgaaggaactactgctgaagtacagtaaggatcccctt gtcatacacagcgtgtggtatgaatactccctctga

DBGET integrated database retrieval system