Anolis sagrei ordinatus (Brown anole): 132775648 Help Entry 132775648         CDS       T09595                                  Name (RefSeq) calmodulin-A-like   KO K02183   calmodulin Organism asao  Anolis sagrei ordinatus (Brown anole) Pathway asao04020   Calcium signaling pathway asao04070   Phosphatidylinositol signaling system asao04114   Oocyte meiosis asao04218   Cellular senescence asao04261   Adrenergic signaling in cardiomyocytes asao04270   Vascular smooth muscle contraction asao04371   Apelin signaling pathway asao04625   C-type lectin receptor signaling pathway asao04744   Phototransduction asao04910   Insulin signaling pathway asao04912   GnRH signaling pathway asao04916   Melanogenesis Brite KEGG Orthology (KO) [BR:asao00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     132775648    04020 Calcium signaling pathway     132775648    04070 Phosphatidylinositol signaling system     132775648  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     132775648    04218 Cellular senescence     132775648  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     132775648   09152 Endocrine system    04910 Insulin signaling pathway     132775648    04912 GnRH signaling pathway     132775648    04916 Melanogenesis     132775648   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     132775648    04270 Vascular smooth muscle contraction     132775648   09157 Sensory system    04744 Phototransduction     132775648  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:asao01009]     132775648   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:asao04131]     132775648    03036 Chromosome and associated proteins [BR:asao03036]     132775648   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:asao04147]     132775648 Protein phosphatases and associated proteins [BR:asao01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      132775648 Membrane trafficking [BR:asao04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     132775648 Chromosome and associated proteins [BR:asao03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      132775648 Exosome [BR:asao04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    132775648 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 Dockerin_1 EH SPARC_Ca_bdg EF-hand_11 DUF5580_M UPF0154 EF_EFCAB10_C EFhand_Ca_insen RNA_pol_Rpb4 DUF1103 TerB Caleosin SurA_N_3 SPEF2_C FCaBP_EF-hand SurA_N_2 Fe_hyd_lg_C PhageMin_Tail Motif Other DBs NCBI-GeneID:  132775648 NCBI-ProteinID:  XP_060632377 LinkDB All DBs Position Unknown AA seq 150 aa AA seqDB search MASHSFSEEQVSEFKEAFLLFDKDGDGAITSQELGTVMRSLGQNPTEAELQEMIRKLDTD GNGMVDFPEFLNLLARRMKNADSEDEVRKAFQVFDKDGNGYVSAAELRHIMTKLGEKLTD EEVEEMIKEADVDGDGQVNYEEFVRIMSCK NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atggcttcccattcgttttcagaggagcaggtctccgagtttaaggaagccttcctgctc ttcgacaaggatggggatggtgccatcacctcccaagagctgggcacagtcatgaggtcc cttgggcaaaacccaacggaagccgagctgcaggaaatgatcaggaagctggacaccgac gggaatggcatggtggacttccccgagttcctcaacctcttggcccggcggatgaagaac gccgacagtgaggacgaagtccggaaggccttccaggtatttgataaggatggcaatggc tacgtcagcgcagccgagctgaggcacatcatgaccaagctgggcgagaagctgacggac gaagaagtggaggagatgatcaaggaggccgatgtggatggagacgggcaagtcaactat gaagagttcgtccggatcatgtcctgcaagtag

DBGET integrated database retrieval system