Anolis sagrei ordinatus (Brown anole): 132778766 Help Entry 132778766         CDS       T09595                                  Symbol NPY Name (RefSeq) pro-neuropeptide Y   KO K05232   neuropeptide Y Organism asao  Anolis sagrei ordinatus (Brown anole) Pathway asao04080   Neuroactive ligand-receptor interaction asao04920   Adipocytokine signaling pathway Brite KEGG Orthology (KO) [BR:asao00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     132778766 (NPY)  09150 Organismal Systems   09152 Endocrine system    04920 Adipocytokine signaling pathway     132778766 (NPY)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:asao04052]     132778766 (NPY) Cytokines and neuropeptides [BR:asao04052]  Neuropeptides   GPCR binding    132778766 (NPY) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_3 Motif Other DBs NCBI-GeneID:  132778766 NCBI-ProteinID:  XP_060638068 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MQGTMRLWLSMMTLALCLLICLGSLAEAYPSKPDSPGEDAPAEDMARYYSALRHYINLIT RQRYGKRSSPETLISDLLLRESTENIPRSRYEDPAMW NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgcaggggaccatgcggttgtggctgtcaatgatgacccttgccttgtgcctgctgatc tgcctggggtcactggcagaagcatatccatccaaaccggacagtccaggtgaggatgcc ccagcagaagacatggccagatattactcggctctgaggcattacatcaacctcatcaca cggcagaggtatggaaagcggtccagtccagagacactgatctccgatcttttgttgaga gaaagcacagaaaacatccccaggtctagatatgaagatcctgcaatgtggtga

DBGET integrated database retrieval system