Anolis sagrei ordinatus (Brown anole): 132779476 Help Entry 132779476         CDS       T09595                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism asao  Anolis sagrei ordinatus (Brown anole) Pathway asao04060   Cytokine-cytokine receptor interaction asao04218   Cellular senescence asao04620   Toll-like receptor signaling pathway asao04621   NOD-like receptor signaling pathway asao04622   RIG-I-like receptor signaling pathway asao05132   Salmonella infection Brite KEGG Orthology (KO) [BR:asao00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     132779476  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     132779476  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     132779476    04621 NOD-like receptor signaling pathway     132779476    04622 RIG-I-like receptor signaling pathway     132779476  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     132779476  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:asao04052]     132779476    00536 Glycosaminoglycan binding proteins [BR:asao00536]     132779476 Cytokines and neuropeptides [BR:asao04052]  Cytokines   Chemokines    132779476 Glycosaminoglycan binding proteins [BR:asao00536]  Heparan sulfate / Heparin   Chemokines    132779476 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 SAND Motif Other DBs NCBI-GeneID:  132779476 NCBI-ProteinID:  XP_060639147 LinkDB All DBs Position Unknown AA seq 100 aa AA seqDB search MNAKVVVALLAFFLACATLTEGLPMARMGSELRCQCITTHSRFITPKNIQDVKLTQSGPH CTNVEVIATLKDGREVCLEPTANWVKVIIKAILDKAQGNV NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgaacgccaaggttgttgttgcacttctggcttttttcttggcctgcgccactctgacc gaaggtctcccaatggcccggatggggagtgaattgcggtgtcagtgcataaccacccat tccaggttcatcactcccaaaaacatccaggatgtcaaactgactcaaagtgggccccac tgcacaaatgtcgaagtcattgcaactctcaaggatggcagagaggtctgcttggaaccc acagccaactgggtgaaggtgatcatcaaagccatcttggacaaggctcaaggcaatgtc taa

DBGET integrated database retrieval system