Australozyma saopauloensis: 88172595 Help Entry 88172595          CDS       T10743                                  Symbol PUMCH_001530 Name (RefSeq) uncharacterized protein   KO K27246   non-histone chromosomal protein 6 Organism asau  Australozyma saopauloensis Brite KEGG Orthology (KO) [BR:asau00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:asau03036]     88172595 (PUMCH_001530) Chromosome and associated proteins [BR:asau03036]  Eukaryotic type   Nucleosome assembly factors    Histone chaperones     FACT complex      88172595 (PUMCH_001530) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HMG_box HMG_box_2 HMG_box_5 HMG_WDHD1 CHDNT Motif Other DBs NCBI-GeneID:  88172595 NCBI-ProteinID:  XP_062876646 UniProt:  A0AAX4H6V0 LinkDB All DBs Position 2:complement(666831..667025) Genome browser AA seq 64 aa AA seqDB search MFFANENRDVVRAENPGISFGQVGKLLGEKWKALEGDEKTPYEAKAAADKKRYEKEKAEY AKRQ NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgttcttcgccaacgagaacagagacgtcgtcagagctgagaaccccggtatcagtttc ggccaggtcggtaagttgttgggtgagaagtggaaggctttggagggcgacgaaaagacc ccttacgaggccaaggctgctgccgacaagaagcgttacgaaaaagagaaggctgagtat gccaagagacagtag

DBGET integrated database retrieval system