Acidilobus saccharovorans: ASAC_0591 Help Entry ASAC_0591         CDS       T01283                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism asc  Acidilobus saccharovorans Pathway asc03010   Ribosome Brite KEGG Orthology (KO) [BR:asc00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     ASAC_0591   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     ASAC_0591  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:asc03011]     ASAC_0591    04121 Ubiquitin system [BR:asc04121]     ASAC_0591   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:asc04147]     ASAC_0591 Ribosome [BR:asc03011]  Ribosomal proteins   Eukaryotes    Small subunit     ASAC_0591   Archaea     ASAC_0591 Ubiquitin system [BR:asc04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    ASAC_0591 Exosome [BR:asc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    ASAC_0591   Exosomal proteins of colorectal cancer cells    ASAC_0591 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_IS1595 Zn_ribbon_SprT Cas12f1-like_TNB Zn_ribbon_3 Zn_ribbon_RPB9 Zn_ribbon_PriA DUF7479 NRDD MRNIP Zn_Ribbon_1 Motif Other DBs NCBI-ProteinID:  ADL18998 UniProt:  D9Q110 LinkDB All DBs Position complement(592030..592212) Genome browser AA seq 60 aa AA seqDB search MAKQVKAYVHLLYEVDYNNMTIKAKNRKCPKCGNFMAHHLKPVERWHCGYCGYTEFVVQQ NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggcgaagcaggtaaaggcctacgtgcacctgctctacgaggtcgactacaacaacatg actataaaggcaaagaacaggaagtgccccaagtgcggcaactttatggcccaccacctg aagcctgtcgagaggtggcactgtggctactgcggctacacggagttcgtcgtccaacag tga

DBGET integrated database retrieval system