Hoyosella subflava: AS9A_1449 Help Entry AS9A_1449         CDS       T01514                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism asd  Hoyosella subflava Pathway asd00362   Benzoate degradation asd00621   Dioxin degradation asd00622   Xylene degradation asd01100   Metabolic pathways asd01120   Microbial metabolism in diverse environments asd01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:asd00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     AS9A_1449    00622 Xylene degradation     AS9A_1449    00621 Dioxin degradation     AS9A_1449 Enzymes [BR:asd01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      AS9A_1449 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Tautomerase_3 DUF1542 Motif Other DBs NCBI-ProteinID:  AEF39901 UniProt:  F6EH64 LinkDB All DBs Position 1503898..1504077 Genome browser AA seq 59 aa AA seqDB search MPLIQISQTPGLTAEQKRDTIAAVTKAYCEATGKSEKAVWVVINEVPREQWGVGGTPLG NT seq 180 nt NT seq  +upstreamnt  +downstreamnt atgcctttgattcagatatcgcagacccccggactcaccgcggaacagaaacgcgacaca atcgcggccgtcaccaaggcgtactgcgaggccacaggtaagagcgagaaggccgtgtgg gtcgtcatcaacgaggtaccccgcgagcagtggggcgtgggcggcaccccgcttggctga

DBGET integrated database retrieval system