KEGG   Anoxybacillus sediminis: IRT44_02710
Entry
IRT44_02710       CDS       T07711                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
ased  Anoxybacillus sediminis
Brite
KEGG Orthology (KO) [BR:ased00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ased03000]
    IRT44_02710
Transcription factors [BR:ased03000]
 Prokaryotic type
  Other transcription factors
   Others
    IRT44_02710
SSDB
Motif
Pfam: Bmp Peripla_BP_4 Fe-ADH
Other DBs
NCBI-ProteinID: UFJ61783
LinkDB
Position
552079..553077
AA seq 332 aa
MPKLQPFSALFVGLVIALLLLITSQFMTSMTHLQQFNQTGNAKHKLRVALLLEGPTYDQG
WNSSALESLTELKKTYGFSLEVASNLKPEQITAVTQQYASNGYDLIFGHGVIFSEPFTQI
APLYPETRFISFNGEAVHPNQTTICYDMKPAGYLVGKLAATMSKTRKVGYILTDKPTEYK
QLEGFQEGVRNTNSRTQLIVEKVPDFNDVEGATRAAKSMIAKGVDVIYTTGDSYNLAVIT
EAQRANIYAIGYIADQRYIAPNHVLASLIQDVRQCYRTLMAQYTAGTLPSGTVTYGLAEG
VNRLSTFGPMVPPEVRAEMQQEFERLTHHRQQ
NT seq 999 nt   +upstreamnt  +downstreamnt
atgcccaaactgcagccgttttccgccctgttcgtgggtctggtcatcgccctgctcctg
ttgatcaccagccagtttatgaccagcatgacacacctgcagcagttcaaccaaactggg
aatgccaagcacaagctgcgggtggcgctccttttggaagggcccacgtacgaccagggt
tggaacagcagtgcgctggagagcctgacggaattgaagaaaacgtacgggttttccctg
gaagtcgccagcaatctgaagccggaacagattaccgccgtgacgcagcagtacgcctcc
aacggctatgatctgatcttcggtcacggtgtcattttttccgagccgttcacccagatc
gctcccctctacccggagacgcgtttcatctcctttaacggggaagcggtccaccccaac
cagacgaccatctgctacgatatgaaaccggccggctatctcgtcgggaaactggccgcc
accatgtccaagacccgcaaagtcggctatatcctgacggacaaaccgaccgagtacaag
cagttggaaggtttccaggagggggtcagaaacacaaattcgcgcacgcagctaatcgtc
gagaaagtgcctgatttcaacgacgtggagggtgccacccgggccgccaaaagcatgatt
gccaaaggtgtggacgtgatctacacgaccggcgacagctacaatctggcggtcatcacg
gaagcgcagcgggccaacatctacgccattggctacattgccgaccagcgctacatcgcc
cccaaccacgtgctcgcctcgttgattcaggacgtccggcagtgctaccgaaccctgatg
gcccagtacaccgccggcacgcttccttccggtacggtcacctacggtctggccgagggc
gtaaatcggttaagcacgtttggcccgatggtgccgccggaggtacgcgccgaaatgcag
caggaatttgaacgccttactcatcatcgccagcaatag

DBGET integrated database retrieval system