Brevibacillus sedimenti: IRT44_15930 Help Entry IRT44_15930       CDS       T07711                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism ased  Brevibacillus sedimenti Pathway ased02024   Quorum sensing ased03018   RNA degradation Brite KEGG Orthology (KO) [BR:ased00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     IRT44_15930 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     IRT44_15930 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ased03019]     IRT44_15930 (hfq)    03036 Chromosome and associated proteins [BR:ased03036]     IRT44_15930 (hfq) Messenger RNA biogenesis [BR:ased03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      IRT44_15930 (hfq) Chromosome and associated proteins [BR:ased03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     IRT44_15930 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 DUF150_C Motif Other DBs NCBI-ProteinID:  UFJ60734 LinkDB All DBs Position complement(3257791..3258033) Genome browser AA seq 80 aa AA seqDB search MKQSINIQDTFLNHLRKENIAVTIYLVNGFQLRGYIKAFDNFTIVIDSEGKQQLVYKHAI STFTPQRPVSLMSQDNNQQA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgaaacagtcgatcaacattcaagatacgttcctgaaccacttgcggaaggagaacatc gctgtcaccatctacctggtaaacgggtttcaactgcgcggctacatcaaagcgtttgac aactttaccatcgtgattgacagcgaaggtaagcagcagcttgtatacaagcatgccatt tccacgttcacgccgcagcgtcccgtgtcgctcatgtctcaagacaacaatcagcaagca tag

DBGET integrated database retrieval system