Aggregatibacter segnis: NCTC10977_00662 Help Entry NCTC10977_00662   CDS       T06075                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aseg  Aggregatibacter segnis Pathway aseg01100   Metabolic pathways aseg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aseg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC10977_00662    00074 Mycolic acid biosynthesis     NCTC10977_00662   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC10977_00662 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7095 Motif Other DBs NCBI-ProteinID:  SQH64141 LinkDB All DBs Position 1:638818..639081 Genome browser AA seq 87 aa AA seqDB search MELEQQIKQLIIDSLALEDISVEDIENDTALFGDDGLGLDSVDALELGLAVQKTFHLQLD SEQTQVRNHFESVATLASFIRSQKGEA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggaactggaacagcaaattaaacaattaattattgatagtttggcattagaagatatc agtgttgaagatattgaaaatgacaccgcactttttggtgatgatggtttagggttggac tctgttgatgcgcttgaactaggtttggcggtgcaaaaaacatttcatttacagctggat agtgaacaaacccaagtacgtaatcactttgaaagtgtagcgaccttggcaagttttatt cgtagtcaaaaaggtgaggcgtaa

DBGET integrated database retrieval system