KEGG   Achromobacter seleniivolatilans: RAS12_27095
Entry
RAS12_27095       CDS       T09953                                 
Name
(GenBank) ATP-binding protein
  KO
K07677  two-component system, NarL family, capsular synthesis sensor histidine kinase RcsC [EC:2.7.13.3]
Organism
asel  Achromobacter seleniivolatilans
Pathway
asel02020  Two-component system
Brite
KEGG Orthology (KO) [BR:asel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RAS12_27095
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:asel01001]
    RAS12_27095
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:asel02022]
    RAS12_27095
Enzymes [BR:asel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     RAS12_27095
Protein kinases [BR:asel01001]
 Histidine kinases
  NarL family
   RAS12_27095
Two-component system [BR:asel02022]
 NarL family
  RcsC-RcsD-RcsB (capsule synthesis)
   RAS12_27095
SSDB
Motif
Pfam: HATPase_c Response_reg HisKA Hpt HATPase_c_3
Other DBs
NCBI-ProteinID: WMD20231
UniProt: A0ABY9LZN7
LinkDB
Position
5991493..5994156
AA seq 887 aa
MIALLILAMGVRMAINTHVDAQRRAFVLGHGLVTEHGYRALVDPVKITGMRGMALIVNPD
GNVVDWVGECCDGGHPPLRETLQRVASVGDEQPQDWHEQGLFIVSQGLGDENVMVFAYAG
SNIAAAASEDVLVDFMLTIPTLGMMWLLLISLKLRVFRPLLEWSRRVYEGEKLSRTLIDT
APVGLGLISLDTGKALLRSPAMAQIAARITSGEDALPEACIQLYKAYVARGDVSWRQGSF
NDDLRFDTLNRIGLDLSVSMVRARYQGKNVLVTAFTDVTAQSRVEQQLRKARQASDRANA
AKSAFLAAMSHEIRTPLNAILGNLELLSHSRLDAAQRDRLRTISTSSNGLLAIVSDVLDF
SKIEAGELRLESIEFDVLDVASQALRMFTATARAKGLTLAGQLGEVVALPMLGDPTRLGQ
VINNLLSNAVKFTEQGSVALALSVDEEQGSLVIEVDDTGIGMSQEQLARLFRAFSQADPT
INRRFGGTGLGLALCSRLAQAMGGTLLVQSEPGRGSRFTLRLPLGNCGQARQMPRFDGER
VALLAGSASWRAYVGRSLQAWGLNVQSYAHPAALKPDLLGEFSAVVLWGDRQGWGVEDEN
RLVEEAPWVIDCGEDGPADPVLMGRLLSVSMIGLKGLASGLDHVLRGTPLSAPELCRPIL
ARRLSVLIAEDNPVNQRLFEEQLRMLGCDPVSVDNGVQALECLERSRFDVLLTDLAMPEM
DGYALAESARERWPSMPVVAASAHMTPQERALCEQAGIALVLGKPLSLGDLAQALSTVTA
VRIRSLEGDKGGGLLGGRAMSEDLKRTYRLACESALAEIGRGRVAGDIPQLLAELHKLRG
MLDVFGEYVLSRLAADAETSLKSGRGLDDVEGLLDALEAGLKRASSP
NT seq 2664 nt   +upstreamnt  +downstreamnt
ttgatcgctttgctgattctcgccatgggcgtgcgcatggcgatcaatacgcacgtcgac
gcgcagcgccgcgcgtttgtgctgggccacggcctggtcacggaacacggataccgcgcg
ctggtcgacccggtcaagatcacgggcatgcggggaatggcgttgatcgtcaaccccgat
ggcaatgtggtcgactgggtgggcgaatgctgcgacggcgggcatccgccattgcgcgaa
acgttgcagcgcgtggcatcagtcggcgacgagcagccgcaggactggcatgaacaaggc
ctgttcatcgtgtcccaaggcctgggcgatgagaacgtgatggtattcgcatacgccggc
agcaatattgcggcggcggccagcgaggatgtcttggttgacttcatgttgacgataccg
acgctcgggatgatgtggctgctgctcatttcgctcaagttgcgagtgttccgtccgctg
ctggaatggtctcggcgcgtatatgaaggcgaaaaactcagccgcaccctgatcgacact
gcgcccgtggggcttggcctgatctcgttggatacgggcaaggcgctgttgcgcagtccg
gccatggcgcagatcgctgcgcgcatcacatccggcgaggatgcgctgcccgaggcgtgc
attcaactgtataaggcgtacgttgcgcgcggcgatgtgagctggcgccaaggctcattt
aacgatgaccttcgattcgacaccctgaaccggatcggtctggacctgtcggtcagcatg
gtacgcgcgcgttatcagggaaagaacgtgctggtaaccgcgttcacggacgtcacggcc
cagagccgtgtcgaacagcagttgcgcaaggcgcggcaggcatcggatcgggccaatgcc
gcgaagtcggcctttctggccgcgatgagccatgagatccgcaccccgttgaacgccatt
ctgggcaatctggagctgttgtcgcattcgcgcctggatgccgcacagcgtgaccggctg
cgcacgatcagcacttcgtccaacggcctgttggcgatcgtcagcgacgtgctggatttc
tcgaagatcgaggccggtgaattgcggcttgagtctatcgagttcgacgtcctggatgtg
gcctcgcaggcattgcggatgttcacggccaccgcgcgcgccaagggcctgactttggcc
ggccagctgggcgaggtcgtggcgcttcccatgttgggtgatccgacgcggttggggcag
gtcatcaacaatctgttgtccaacgcggtcaagttcaccgaacaggggagcgtggcgctg
gcattgtccgttgatgaggagcaggggtcgcttgttattgaggtcgacgacacgggcatc
ggcatgtcgcaagagcaattagccaggttgttccgcgccttcagccaggcagacccgacg
atcaaccggcgctttggcggcacgggcttggggctggcgctgtgttcgcgcttggctcag
gcgatgggtggcaccttgttggtgcagagcgaaccgggacggggcagccgctttacgctg
cgtctgccgctgggcaactgcgggcaggccaggcagatgccgcgctttgatggcgaacgg
gtggcgttgctggccggatcggcgtcatggcgggcctatgtcgggcgcagccttcaggca
tggggcctgaacgtgcagtcttatgcgcatccggcggcgctgaaaccggacttgctgggc
gagttttcggcggtggtgctgtggggcgatcggcaggggtggggggtcgaggacgaaaat
cgtctggttgaagaggcgccttgggtgatagattgcggggaagatgggccggcagacccg
gtgttgatgggccggctgttgagcgtgtcgatgatcggtctgaaggggttggcaagcggc
ttggaccatgttcttcgtggtacgccattgagcgcgccggagttgtgccggccgatattg
gcgcggcgtcttagtgtcttgatcgccgaagacaatcccgtgaatcagcgattgttcgaa
gaacagttgcgcatgttgggttgcgatcccgtgtcggtggataacggggtgcaggcgctg
gaatgcctggaacggtcgaggtttgatgtattgctgactgaccttgcgatgccggaaatg
gacggatatgcgctggcggagtccgcgcgcgaacgctggccatccatgccggttgtggct
gccagcgcgcacatgacgccgcaggagcgggcgttatgcgagcaggcaggcattgccctg
gtgctgggcaaacccttgtcgctgggcgatcttgcgcaagcgctgtcgacggtaacggct
gtgcggatcagaagcctggaaggggataagggaggcggtttgctgggcggccgcgcgatg
agcgaggacctgaagcgcacttaccgcctagcctgcgaatccgcgctggccgaaatcggc
cgtggcagagtggcgggagacatcccgcagctcttggccgagctgcataagctgcgcggc
atgctggatgtttttggcgagtacgtcctgagccggctggcggcagacgctgagacgagt
ctgaagtcgggccgcgggctggacgatgtggagggcttgctggatgcactagaggcaggc
ctgaaacgcgcctcttccccataa

DBGET integrated database retrieval system