Actinocatenispora sera: Asera_26540 Help Entry Asera_26540       CDS       T07446                                  Name (GenBank) hypothetical protein   KO K13993   HSP20 family protein Organism aser  Actinocatenispora sera Pathway aser04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:aser00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     Asera_26540  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:aser03110]     Asera_26540 Chaperones and folding catalysts [BR:aser03110]  Heat shock proteins   HSP20    Asera_26540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HSP20 ArsA_HSP20 Kisspeptin Motif Other DBs NCBI-ProteinID:  BCJ28546 UniProt:  A0A810L266 LinkDB All DBs Position 2760966..2761274 Genome browser AA seq 102 aa AA seqDB search MRLDLPGIDEESLEVTAENNTLTVRARRDVDAPKGAEFVMRERPVGTFNRQMVLGDGLDL ERVSAQYRDGVLTASIPVAEHARPRRIPITRSGSDRKVIEAG NT seq 309 nt NT seq  +upstreamnt  +downstreamnt gtgcggctcgacctgcccgggatcgacgaggaatcgctggaagtcacggccgagaacaac acgctcacggtgcgggcacggcgagacgtggacgcaccgaagggcgcggagttcgtgatg cgcgagcgtccggtcggcacgttcaaccggcagatggtgctgggtgacgggctcgacctg gagagggtgtcggcgcagtaccgcgacggcgtgctgaccgcgtcgattccggtcgccgag cacgcccggccgcgccggatcccgatcacccgctccggcagtgaccggaaggtgatcgag gcgggctga

DBGET integrated database retrieval system