Actinocatenispora sera: Asera_54650 Help Entry Asera_54650       CDS       T07446                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aser  Actinocatenispora sera Pathway aser01100   Metabolic pathways aser01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aser00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Asera_54650 (acpP)    00074 Mycolic acid biosynthesis     Asera_54650 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Asera_54650 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  BCJ31357 UniProt:  A0A810L7Z2 LinkDB All DBs Position 5790236..5790478 Genome browser AA seq 80 aa AA seqDB search MTRDEIRTGLADILEEVAGVDKSDVADEKSFTEELDVDSLSMVEVVVAAEEKFGVKIPDD EVPNLKTVGDAVTYIEKNAA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacccgcgacgagattcgcaccggcctggccgacatcctggaagaggtggccggcgtg gacaagtccgacgtcgccgacgagaagtcgttcaccgaggagctggacgtcgactcgctg tcgatggtggaggtcgtggtcgccgccgaggagaagttcggcgtgaagatccccgacgac gaggtcccgaacctgaagaccgtcggcgacgcggtcacctacatcgagaagaacgcggcc tga

DBGET integrated database retrieval system