Actinocatenispora sera: Asera_58430
Help
Entry
Asera_58430 CDS
T07446
Name
(GenBank) ferredoxin
KO
K00124
formate dehydrogenase iron-sulfur subunit
Organism
aser
Actinocatenispora sera
Pathway
aser00630
Glyoxylate and dicarboxylate metabolism
aser00680
Methane metabolism
aser01100
Metabolic pathways
aser01120
Microbial metabolism in diverse environments
aser01200
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:
aser00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00630 Glyoxylate and dicarboxylate metabolism
Asera_58430
09102 Energy metabolism
00680 Methane metabolism
Asera_58430
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Fer4_11
Fer4_7
Fer4_6
Fer4_9
Fer4_2
Fer4_10
Fer4
Fer4_16
Fer4_3
Fer4_4
Fer4_8
Fer4_21
Motif
Other DBs
NCBI-ProteinID:
BCJ31735
UniProt:
A0A810LA26
LinkDB
All DBs
Position
6181282..6182265
Genome browser
AA seq
327 aa
AA seq
DB search
MALAPHHHPADPASSVGYAEHPPRMGFFTDTSVCIGCKACEVACKEWNGVPADALDLTGM
SYDNTGGLGADNWRHVAFIEQRRPLGTAHTGVGHDDVDVLALAEQGSATPPEQASATPTS
PPRDDAAAGPPQPDGRTELRWLMASDVCKHCTEAACLDVCPTGSLFRTEFGTVVVQEDIC
NGCGYCIPACPYGVIDQRKDDGRAWKCTMCYDRLGAGMEPACAKACPTDSIQYGQLDELR
ERADARLRTLHDAGVDDARLYGRDPHDGVGGDGAFFLLLDEPETYGLPPDPTVTTRDLPS
MWRRVGFAAGALAAAAVAAFVTTRRSR
NT seq
984 nt
NT seq
+upstream
nt +downstream
nt
atggctctcgccccacaccaccatcccgccgatccggccagttcggtcgggtatgccgag
catccgccgcggatggggttcttcaccgacaccagcgtctgcatcggctgcaaggcgtgc
gaggtcgcctgcaaggagtggaacggggtgccggcggacgcgctggacctgaccggcatg
tcgtacgacaacaccggcgggctgggggccgacaactggcggcacgtggcgttcatcgag
cagcgccgaccccttggtaccgcgcacaccggggtcggccacgacgacgtcgacgtgctg
gcgctcgccgagcaggggtcggccaccccgccggagcaggcgtccgcgaccccgacctcc
ccgccccgcgacgatgcggctgctgggccaccgcagccggacgggcggaccgagctgcgc
tggctgatggcctccgacgtgtgcaagcactgcaccgaggcggcctgcctggacgtgtgc
ccgaccggctcgctgtttcgtaccgagttcggcaccgtggtcgtgcaggaggacatctgc
aacggctgcggctactgcattccggcctgcccgtacggggtgatcgaccagcgcaaggac
gacggacgggcctggaagtgcacgatgtgctacgaccggctcggcgccgggatggaaccc
gcctgcgccaaggcctgccccaccgactccatccagtacggccagctcgacgagctgcgc
gagcgcgccgacgcgcgcctgcgcacgctgcacgacgccggtgtcgacgacgcccggctg
tacggccgggacccgcacgacggggtgggcggcgacggcgcgttcttcctgctgctggac
gagccggaaacctacggactgccgcccgatccgaccgtcaccacccgggatctgccgtcc
atgtggcgccgggtcgggttcgccgccggcgcgctggccgccgccgcggtcgccgccttc
gtcaccacccggaggagccgatga
DBGET
integrated database retrieval system