Alistipes shahii: AL1_06920 Help Entry AL1_06920         CDS       T02578                                  Name (GenBank) 4Fe-4S binding domain.   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ash  Alistipes shahii Pathway ash00020   Citrate cycle (TCA cycle) ash00720   Other carbon fixation pathways ash01100   Metabolic pathways ash01110   Biosynthesis of secondary metabolites ash01120   Microbial metabolism in diverse environments ash01200   Carbon metabolism ash01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:ash00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     AL1_06920   09102 Energy metabolism    00720 Other carbon fixation pathways     AL1_06920 Enzymes [BR:ash01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      AL1_06920 SSDB OrthologParalogGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_2 Fer4_7 Fer4_21 Fer4_10 Fer4_4 LdpA_Fe-S-bd Fer4_15 Fer4_16 Fer4_9 Fer4_13 Fer4_3 Fer4_22 Fer4_8 Motif Other DBs NCBI-ProteinID:  CBK63288 UniProt:  D4IK26 LinkDB All DBs Position complement(796966..797193) Genome browser AA seq 75 aa AA seqDB search MAKIKGTIVVDKERCKGCGVCASACPCDVLALSAEVNSKGYPVAWMVNPDSCTGCASCAV ICPDSCITVYRQKFE NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaatcaaaggaacaatcgttgtcgacaaggagcgctgcaaggggtgcggggtc tgtgcttcggcctgtccgtgcgacgtgctcgcgctgtcggcggaggtcaacagcaaaggt tatcccgttgcgtggatggtcaatcccgattcctgcacgggctgtgcctcctgtgcggtg atttgtccggatagctgcattacggtttatcgtcaaaaattcgagtaa

DBGET integrated database retrieval system