Alistipes shahii: AL1_13090 Help Entry AL1_13090         CDS       T02578                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ash  Alistipes shahii Pathway ash01100   Metabolic pathways ash01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ash00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AL1_13090    00074 Mycolic acid biosynthesis     AL1_13090   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AL1_13090 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Guanylate_cyc DUF1493 Motif Other DBs NCBI-ProteinID:  CBK63777 UniProt:  D4ILG5 LinkDB All DBs Position 1493969..1494205 Genome browser AA seq 78 aa AA seqDB search MSEVQSKVVEIIVDKLGVKESEVVPEASFTNHLGADSLDTVELIMEFEKAFDIQIPDEDA EKIATVGDAISYIEEHKK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcagaagttcaatcaaaagttgtcgagatcatcgtcgacaaactgggtgtcaaggag tcggaggtagtccccgaagcaagcttcaccaaccacctgggcgcagactcgctcgacact gtagagctgatcatggagttcgagaaggctttcgatatccagatcccggatgaggacgct gaaaagatcgctaccgtcggcgacgcgatctcgtatatcgaggaacacaagaaataa

DBGET integrated database retrieval system