Actinobacillus suis H91-0380: ASU2_09705 Help Entry ASU2_09705        CDS       T02262                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism asi  Actinobacillus suis H91-0380 Pathway asi01100   Metabolic pathways asi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:asi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ASU2_09705    00074 Mycolic acid biosynthesis     ASU2_09705   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ASU2_09705 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AFU20069 UniProt:  K0G8N8 LinkDB All DBs Position 2120720..2120977 Genome browser AA seq 85 aa AA seqDB search MELELQLKQLIIDSLGLEDMSVEDIETDAPLFGDDGLGLDSVDALELGLAVQKTFGLQLD SEKQNLRNHFESVATLATFIRSIKG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggaacttgaactgcaattaaaacaattaattatcgatagccttggtcttgaagatatg agcgtagaggatattgaaacggatgctccacttttcggtgatgatgggttgggtttagat tcagtagacgcacttgaacttggtttagcggtacaaaaaacttttggattacaactagat agcgaaaagcagaatttacgtaatcactttgaaagtgttgcgacattagcaacatttatt cgttcgattaaggggtaa

DBGET integrated database retrieval system